Lineage for d1jgqf_ (1jgq F:)

  1. Root: SCOP 1.59
  2. 146111Class i: Low resolution protein structures [58117] (16 folds)
  3. 146112Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 146113Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 146114Family i.1.1.1: Ribosome complexes [58120] (1 protein)
  6. 146115Protein 70S ribosome functional complex [58121] (2 species)
  7. 146143Species Thermus thermophilus [TaxId:274] [58122] (9 PDB entries)
  8. 146209Domain d1jgqf_: 1jgq F: [62999]

Details for d1jgqf_

PDB Entry: 1jgq (more details), 5 Å

PDB Description: the path of messenger rna through the ribosome. this file, 1jgq, contains the 30s ribosome subunit, three trna, and mrna molecules. 50s ribosome subunit is in the file 1giy

SCOP Domain Sequences for d1jgqf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jgqf_ i.1.1.1 (F:) 70S ribosome functional complex {Thermus thermophilus}
gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
idygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1jgqf_:

Click to download the PDB-style file with coordinates for d1jgqf_.
(The format of our PDB-style files is described here.)

Timeline for d1jgqf_: