SCOPe 2.06: Domain d1jf0a_: 1jf0 A:

Lineage for d1jf0a_ (1jf0 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calcium-regulated photoprotein [47512] (4 species)
   structurally most similar to sarcoplasmic calcium-binding protein

7. Species Hydrozoa (Obelia geniculata), obelin [TaxId:185004] [63542] (1 PDB entry)

8. Domain d1jf0a_: 1jf0 A: [62926]
   complexed with czh

Details for d1jf0a_

PDB Entry: 1jf0, 1.82 Å

PDB Description: the crystal structure of obelin from obelia geniculata at 1.82 a resolution

PDB Compounds: (A:) obelin

SCOPe Domain Sequences for d1jf0a_:

Sequence; same for both SEQRES and ATOM records:

>d1jf0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia geniculata), obelin [TaxId: 185004]}
kyavklqtdfdnpkwikrhkfmfdyldingngqitldeivskasddicknlgatpaqtqr
hqdcveaffrgcgleygketkfpeflegwknlanadlakwarneptlirewgdavfdifd
kdgsgtitldewkaygrisgispseedcektfqhcdldnsgeldvdemtrqhlgfwytld
peadglygngvp

Timeline for d1jf0a_:

• d1jf0a_ first appeared in SCOP 1.57
  
• d1jf0a_ appears in SCOPe 2.05
  
• d1jf0a_ appears in SCOPe 2.07
  
• d1jf0a_ appears in the current release, SCOPe 2.08