Lineage for d1jbbb_ (1jbb B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2938974Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2938975Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2938976Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2938984Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)
  7. 2939002Species Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId:4932] [64239] (5 PDB entries)
  8. 2939005Domain d1jbbb_: 1jbb B: [62843]

Details for d1jbbb_

PDB Entry: 1jbb (more details), 2 Å

PDB Description: Ubiquitin Conjugating Enzyme, Ubc13
PDB Compounds: (B:) ubiquitin conjugating enzyme E2-17.5 KDA

SCOPe Domain Sequences for d1jbbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbbb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc13 [TaxId: 4932]}
slpkriiketeklvsdpvpgitaephddnlryfqvtiegpeqspyedgifelelylpddy
pmeapkvrfltkiyhpnidrlgricldvlktnwspalqirtvllsiqallaspnpndpla
ndvaedwikneqgakakarewtklyak

SCOPe Domain Coordinates for d1jbbb_:

Click to download the PDB-style file with coordinates for d1jbbb_.
(The format of our PDB-style files is described here.)

Timeline for d1jbbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1jbba_