Lineage for d1j87a2 (1j87 A:86-171)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (22 proteins) 
Protein IgE high affinity receptor alpha subunit [49200] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49201] (6 PDB entries) 
Domain d1j87a2: 1j87 A:86-171 [62716]
Details for d1j87a2
PDB Entry: 1j87 (more details), 3.2 Å
PDB Description: human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1
SCOP Domain Sequences for d1j87a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j87a2 b.1.1.4 (A:86-171) IgE high affinity receptor alpha subunit {Human (Homo sapiens)}
dwlllqasaevvmegqplflrchgwrnwdvykviyykdgealkywyenhnisitnatved
sgtyyctgkvwqldyeseplnitvck
SCOP Domain Coordinates for d1j87a2:
Click to download the PDB-style file with coordinates for d1j87a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1j87a2:
- d1j87a2 is new in SCOP 1.57
- d1j87a2 appears in SCOP 1.59
- d1j87a2 appears in the current release, SCOPe 2.08
View in 3D
