PDB entry 1j87

View 1j87 on RCSB PDB site
Description: human high affinity fc receptor fc(epsilon)ri(alpha), hexagonal crystal form 1
Deposited on 2001-05-20, released 2001-08-29
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-29, with a file datestamp of 2001-08-29.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.264
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1j87A (A:)
    vpqkpkvslnppwnrifkgenvtltcngnnffevsstkwfhngslseetnsslnivnakf
    edsgeykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviy
    ykdgealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvck
    

    Sequence, based on observed residues (ATOM records): (download)
    >1j87A (A:)
    vpqkpkvslnppwnrifkgenvtltcngnnffstkwfhngslseetnsslnivnakfeds
    geykcqhqqvnesepvylevfsdwlllqasaevvmegqplflrchgwrnwdvykviyykd
    gealkywyenhnisitnatvedsgtyyctgkvwqldyeseplnitvck