Lineage for d1j7ub_ (1j7u B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197199Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
  4. 197200Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
  5. 197491Family d.144.1.6: Type IIIa 3',5"-aminoglycoside phosphotransferase [64411] (1 protein)
  6. 197492Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)
  7. 197493Species Enterococcus faecalis [TaxId:1351] [64413] (5 PDB entries)
  8. 197497Domain d1j7ub_: 1j7u B: [62703]

Details for d1j7ub_

PDB Entry: 1j7u (more details), 2.4 Å

PDB Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa AMPPNP Complex

SCOP Domain Sequences for d1j7ub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7ub_ d.144.1.6 (B:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

SCOP Domain Coordinates for d1j7ub_:

Click to download the PDB-style file with coordinates for d1j7ub_.
(The format of our PDB-style files is described here.)

Timeline for d1j7ub_: