PDB entry 1j7u

View 1j7u on RCSB PDB site
Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa AMPPNP Complex
Deposited on 2001-05-18, released 2001-08-08
The last revision prior to the SCOP 1.61 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1j7ua_
  • Chain 'B':
    Domains in SCOP 1.61: d1j7ub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7uA (A:)
    akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
    dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
    fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
    eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
    fdllgikpdwekikyyilldelf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1j7uB (B:)
    akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
    dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
    fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
    eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
    fdllgikpdwekikyyilldelf