SCOP 1.59: Domain d1j7lb_: 1j7l B:

Lineage for d1j7lb_ (1j7l B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)

5. Family d.144.1.6: Type IIIa 3',5"-aminoglycoside phosphotransferase [64411] (1 protein)

6. Protein Type IIIa 3',5"-aminoglycoside phosphotransferase [64412] (1 species)

7. Species Enterococcus faecalis [TaxId:1351] [64413] (3 PDB entries)

8. Domain d1j7lb_: 1j7l B: [62698]

Details for d1j7lb_

PDB Entry: 1j7l, 2.2 Å

PDB Description: Crystal Structure of 3',5"-Aminoglycoside Phosphotransferase Type IIIa ADP Complex

SCOP Domain Sequences for d1j7lb_:

Sequence; same for both SEQRES and ATOM records:

>d1j7lb_ d.144.1.6 (B:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis}
akmrispelkkliekyrcvkdtegmspakvyklvgenenlylkmtdsrykgttydverek
dmmlwlegklpvpkvlhferhdgwsnllmseadgvlcseeyedeqspekiielyaecirl
fhsidisdcpytnsldsrlaeldyllnndladvdcenweedtpfkdprelydflktekpe
eelvfshgdlgdsnifvkdgkvsgfidlgrsgradkwydiafcvrsiredigeeqyvelf
fdllgikpdwekikyyilldelf

Timeline for d1j7lb_:

• d1j7lb_ first appeared in SCOP 1.57
  
• d1j7lb_ appears in SCOP 1.61
  
• d1j7lb_ appears in the current release, SCOPe 2.08