Class f: Membrane and cell surface proteins and peptides [56835] (11 folds) |
Fold f.2: Membrane all-alpha [56868] (1 superfamily) |
Superfamily f.2.1: Membrane all-alpha [56869] (10 families) |
Family f.2.1.4: F1F0 ATP synthase subunits [56890] (2 proteins) |
Protein Subunit C [56891] (1 species) |
Species Escherichia coli [TaxId:562] [56892] (5 PDB entries) |
Domain d1j7fh_: 1j7f H: [62689] |
PDB Entry: 1j7f (more details)
SCOP Domain Sequences for d1j7fh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7fh_ f.2.1.4 (H:) Subunit C {Escherichia coli} menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv daipmiavglglyvmfava
Timeline for d1j7fh_: