Lineage for d1j7fh_ (1j7f H:)

  1. Root: SCOP 1.57
  2. 87528Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 87593Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 87594Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 87876Family f.2.1.4: F1F0 ATP synthase subunits [56890] (2 proteins)
  6. 87880Protein Subunit C [56891] (1 species)
  7. 87881Species Escherichia coli [TaxId:562] [56892] (5 PDB entries)
  8. 87904Domain d1j7fh_: 1j7f H: [62689]

Details for d1j7fh_

PDB Entry: 1j7f (more details)

PDB Description: subunit c oligomer of the e.coli atp synthase

SCOP Domain Sequences for d1j7fh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7fh_ f.2.1.4 (H:) Subunit C {Escherichia coli}
menlnmdllymaaavmmglaaigaaigigilggkflegaarqpdlipllrtqffivmglv
daipmiavglglyvmfava

SCOP Domain Coordinates for d1j7fh_:

Click to download the PDB-style file with coordinates for d1j7fh_.
(The format of our PDB-style files is described here.)

Timeline for d1j7fh_: