Lineage for d1iofa_ (1iof A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 997543Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 997544Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
  6. 997545Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 997559Species Pyrococcus furiosus [TaxId:2261] [64099] (7 PDB entries)
  8. 997572Domain d1iofa_: 1iof A: [62625]
    mutant

Details for d1iofa_

PDB Entry: 1iof (more details), 2.2 Å

PDB Description: x-ray crystalline structures of pyrrolidone carboxyl peptidase from a hyperthermophile, pyrococcus furiosus, and its cys-free mutant
PDB Compounds: (A:) pyrrolidone carboxyl peptidase

SCOPe Domain Sequences for d1iofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iofa_ c.56.4.1 (A:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylcnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmcyemeleavkvaievaleell

SCOPe Domain Coordinates for d1iofa_:

Click to download the PDB-style file with coordinates for d1iofa_.
(The format of our PDB-style files is described here.)

Timeline for d1iofa_: