Lineage for d1imxa_ (1imx A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029609Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 3029610Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 3029611Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 3029834Protein Insulin-like growth factor [57002] (1 species)
  7. 3029835Species Human (Homo sapiens) [TaxId:9606] [57003] (23 PDB entries)
    Uniprot P05019 49-110
  8. 3029836Domain d1imxa_: 1imx A: [62593]
    complexed with br, cpq

Details for d1imxa_

PDB Entry: 1imx (more details), 1.82 Å

PDB Description: 1.8 Angstrom crystal structure of IGF-1
PDB Compounds: (A:) Insulin-like Growth Factor 1A

SCOPe Domain Sequences for d1imxa_:

Sequence, based on SEQRES records: (download)

>d1imxa_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemyca
pl

Sequence, based on observed residues (ATOM records): (download)

>d1imxa_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
etlcgaelvdalqfvcgdrgfyfnkptgygsstgivdeccfrscdlrrlemycapl

SCOPe Domain Coordinates for d1imxa_:

Click to download the PDB-style file with coordinates for d1imxa_.
(The format of our PDB-style files is described here.)

Timeline for d1imxa_: