SCOP 1.59: Domain d1ijfb_: 1ijf B:

Lineage for d1ijfb_ (1ijf B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.12: eEF-1beta-like [54984] (1 family)

5. Family d.58.12.1: eEF-1beta-like [54985] (2 proteins)

6. Protein Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta [54986] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [54988] (4 PDB entries)

8. Domain d1ijfb_: 1ijf B: [62492]
   Other proteins in same PDB: d1ijfa1, d1ijfa2, d1ijfa3

Details for d1ijfb_

PDB Entry: 1ijf, 3 Å

PDB Description: Nucleotide exchange mechanisms in the eEF1A-eEF1Ba complex

SCOP Domain Sequences for d1ijfb_:

Sequence; same for both SEQRES and ATOM records:

>d1ijfb_ d.58.12.1 (B:) Guanine nucleotide exchange factor (GEF) domain from elongation factor-1 beta {Baker's yeast (Saccharomyces cerevisiae)}
paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
dkvslddlqqsieededhvqstdiaamqkl

Timeline for d1ijfb_:

• d1ijfb_ first appeared in SCOP 1.57
  
• d1ijfb_ appears in SCOP 1.61
  
• d1ijfb_ appears in the current release, SCOPe 2.08