Lineage for d1ij9a1 (1ij9 A:91-196)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031444Family b.1.1.3: C2 set domains [49142] (8 proteins)
  6. 2031524Protein Vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species)
  7. 2031525Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries)
  8. 2031530Domain d1ij9a1: 1ij9 A:91-196 [62482]
    Other proteins in same PDB: d1ij9a2
    D2

Details for d1ij9a1

PDB Entry: 1ij9 (more details), 3 Å

PDB Description: Highly Hydrated Human VCAM-1 Fragment
PDB Compounds: (A:) vascular cell adhesion protein 1

SCOPe Domain Sequences for d1ij9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ij9a1 b.1.1.3 (A:91-196) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}
fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle
tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvy

SCOPe Domain Coordinates for d1ij9a1:

Click to download the PDB-style file with coordinates for d1ij9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ij9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ij9a2