![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.3: C2 set domains [49142] (8 proteins) |
![]() | Protein Vascular cell adhesion molecule-1 (VCAM-1) [49143] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49144] (3 PDB entries) |
![]() | Domain d1ij9a1: 1ij9 A:91-196 [62482] Other proteins in same PDB: d1ij9a2 D2 |
PDB Entry: 1ij9 (more details), 3 Å
SCOPe Domain Sequences for d1ij9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ij9a1 b.1.1.3 (A:91-196) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} fpkdpeihlsgpleagkpitvkcsvadvypfdrleidllkgdhlmksqefledadrksle tkslevtftpviedigkvlvcraklhidemdsvptvrqavkelqvy
Timeline for d1ij9a1: