Lineage for d1iilg1 (1iil G:150-250)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54308Protein Fibroblast growth factor receptor, FGFR [49179] (2 species)
  7. 54322Species Human (Homo sapiens), FGFR2 [TaxId:9606] [49181] (5 PDB entries)
  8. 54335Domain d1iilg1: 1iil G:150-250 [62441]
    Other proteins in same PDB: d1iila_, d1iilb_, d1iilc_, d1iild_

Details for d1iilg1

PDB Entry: 1iil (more details), 2.3 Å

PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2

SCOP Domain Sequences for d1iilg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iilg1 b.1.1.4 (G:150-250) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2}
nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvve

SCOP Domain Coordinates for d1iilg1:

Click to download the PDB-style file with coordinates for d1iilg1.
(The format of our PDB-style files is described here.)

Timeline for d1iilg1: