Lineage for d1iild_ (1iil D:)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.42: beta-Trefoil [50352] (5 superfamilies) Superfamily b.42.1: Cytokine [50353] (2 families) 
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (5 proteins) Protein Basic FGF (FGF2) [50355] (1 species) Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries) 
Domain d1iild_: 1iil D: [62436]
Other proteins in same PDB: d1iile1, d1iile2, d1iilf1, d1iilf2, d1iilg1, d1iilg2, d1iilh1, d1iilh2
Details for d1iild_
PDB Entry: 1iil (more details), 2.3 Å
PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
SCOP Domain Sequences for d1iild_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iild_ b.42.1.1 (D:) Basic FGF (FGF2) {Human (Homo sapiens)}
pghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanry
lamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgpg
qkailflpmsak
SCOP Domain Coordinates for d1iild_:
Click to download the PDB-style file with coordinates for d1iild_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iild_:
- d1iild_ is new in SCOP 1.57
- d1iild_ appears in SCOP 1.59
- d1iild_ appears in the current release, SCOPe 2.08
View in 3D
