Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins) |
Protein Basic FGF (FGF2) [50355] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [50356] (19 PDB entries) |
Domain d1iilb_: 1iil B: [62434] Other proteins in same PDB: d1iile1, d1iile2, d1iilf1, d1iilf2, d1iilg1, d1iilg2, d1iilh1, d1iilh2 mutant |
PDB Entry: 1iil (more details), 2.3 Å
SCOPe Domain Sequences for d1iilb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iilb_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]} ppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanr ylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgp gqkailflpmsak
Timeline for d1iilb_: