Lineage for d1iilb_ (1iil B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1126115Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1126116Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1126117Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 1126221Protein Basic FGF (FGF2) [50355] (1 species)
  7. 1126222Species Human (Homo sapiens) [TaxId:9606] [50356] (16 PDB entries)
  8. 1126236Domain d1iilb_: 1iil B: [62434]
    Other proteins in same PDB: d1iile1, d1iile2, d1iilf1, d1iilf2, d1iilg1, d1iilg2, d1iilh1, d1iilh2
    mutant

Details for d1iilb_

PDB Entry: 1iil (more details), 2.3 Å

PDB Description: crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
PDB Compounds: (B:) heparin-binding growth factor 2

SCOPe Domain Sequences for d1iilb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iilb_ b.42.1.1 (B:) Basic FGF (FGF2) {Human (Homo sapiens) [TaxId: 9606]}
ppghfkdpkrlycknggfflrihpdgrvdgvreksdphiklqlqaeergvvsikgvsanr
ylamkedgrllasksvtdecffferlesnnyntyrsrkytswyvalkrtgqyklgsktgp
gqkailflpmsak

SCOPe Domain Coordinates for d1iilb_:

Click to download the PDB-style file with coordinates for d1iilb_.
(The format of our PDB-style files is described here.)

Timeline for d1iilb_: