Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein Rad50 [52691] (1 species) |
Species Pyrococcus furiosus [TaxId:2261] [52692] (4 PDB entries) |
Domain d1ii8.1: 1ii8 A:,B: [62417] N- and C-terminal subdomains; include a small fragment of the middle coiled coil domain complexed with po4 |
PDB Entry: 1ii8 (more details), 3.02 Å
SCOPe Domain Sequences for d1ii8.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ii8.1 c.37.1.12 (A:,B:) Rad50 {Pyrococcus furiosus [TaxId: 2261]} mklervtvknfrshsdtvvefkeginliigqngsgksslldailvglywplrikdikkde ftkvgardtyidlifekdgtkyritrrflkgyssgeihamkrlvgnewkhvtepsskais afmeklipyniflnaiyirqgqidailesdearekvvrevlnldkfetaykklselkkti nnrikeyrdilarteXrervkkeikdlekakdfteeliekvkkykalareaalskigela seifaeftegkysevvvraeenkvrlfvvwegkerpltflsggerialglafrlamslyl ageisllildeptpyldeerrrklitimerylkkipqvilvshdeelkdaadhvirisle ngsskvevvs
Timeline for d1ii8.1: