![]() | Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
![]() | Fold c.103: Hypothetical protein MT938 (MTH938) [64075] (1 superfamily) |
![]() | Superfamily c.103.1: Hypothetical protein MT938 (MTH938) [64076] (1 family) ![]() |
![]() | Family c.103.1.1: Hypothetical protein MT938 (MTH938) [64077] (1 protein) |
![]() | Protein Hypothetical protein MT938 (MTH938) [64078] (1 species) |
![]() | Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [64079] (1 PDB entry) |
![]() | Domain d1ihna_: 1ihn A: [62388] |
PDB Entry: 1ihn (more details), 2.2 Å
SCOP Domain Sequences for d1ihna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ihna_ c.103.1.1 (A:) Hypothetical protein MT938 (MTH938) {Archaeon Methanobacterium thermoautotrophicum} shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc
Timeline for d1ihna_: