PDB entry 1ihn

View 1ihn on RCSB PDB site
Description: mt938
Deposited on 2001-04-19, released 2001-05-16
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-15, with a file datestamp of 2001-08-15.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.228
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ihna_
  • Chain 'B':
    Domains in SCOP 1.57: d1ihnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ihnA (A:)
shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ihnB (B:)
shmfsdcrfgsvtyrgreyrsdivvhvdgsvtprrkeisrrkygtshvmaeeeleellee
kpesiiigsgvhgaletgfrsdatvlptceaikryneersagrrvaaiihvtc