Lineage for d1ibjc_ (1ibj C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895682Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)
  6. 2895744Protein Cystathionine beta-lyase, CBL [53403] (2 species)
  7. 2895758Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [64125] (1 PDB entry)
  8. 2895760Domain d1ibjc_: 1ibj C: [62163]
    complexed with co3, plp, so4

Details for d1ibjc_

PDB Entry: 1ibj (more details), 2.3 Å

PDB Description: Crystal structure of cystathionine beta-lyase from Arabidopsis thaliana
PDB Compounds: (C:) Cystathionine beta-lyase

SCOPe Domain Sequences for d1ibjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibjc_ c.67.1.3 (C:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
asvstllvnldnkfdpfdamstplyqtatfkqpsaiengpydytrsgnptrdalesllak
ldkadrafcftsgmaalsavthlikngeeivagddvyggsdrllsqvvprsgvvvkrvnt
tkldevaaaigpqtklvwlesptnprqqisdirkisemahaqgalvlvdnsimspvlsrp
lelgadivmhsatkfiaghsdvmagvlavkgeklakevyflqnsegsglapfdcwlclrg
iktmalriekqqenarkiamylsshprvkkvyyaglpdhpghhlhfsqakgagsvfsfit
gsvalskhlvettkyfsiavsfgsvkslismpcfmshasipaevreargltedlvrisag
iedvddlisdldiafktfpl

SCOPe Domain Coordinates for d1ibjc_:

Click to download the PDB-style file with coordinates for d1ibjc_.
(The format of our PDB-style files is described here.)

Timeline for d1ibjc_: