Lineage for d1ib6c1 (1ib6 C:1-145)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844748Protein Malate dehydrogenase [51849] (13 species)
  7. 2844788Species Escherichia coli [TaxId:562] [51853] (4 PDB entries)
  8. 2844791Domain d1ib6c1: 1ib6 C:1-145 [62150]
    Other proteins in same PDB: d1ib6a2, d1ib6b2, d1ib6c2, d1ib6d2
    complexed with nad, so4

Details for d1ib6c1

PDB Entry: 1ib6 (more details), 2.1 Å

PDB Description: crystal structure of r153c e. coli malate dehydrogenase
PDB Compounds: (C:) malate dehydrogenase

SCOPe Domain Sequences for d1ib6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ib6c1 c.2.1.5 (C:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]}
mkvavlgaaggigqalalllktqlpsgselslydiapvtpgvavdlshiptavkikgfsg
edatpalegadvvlisagvarkpgmdrsdlfnvnagivknlvqqvaktcpkacigiitnp
vnttvaiaaevlkkagvydknklfg

SCOPe Domain Coordinates for d1ib6c1:

Click to download the PDB-style file with coordinates for d1ib6c1.
(The format of our PDB-style files is described here.)

Timeline for d1ib6c1: