Lineage for d1i97g_ (1i97 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718736Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
    core: 5 helices; contains one more helix and a beta-hairpin outside the core
  4. 2718737Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) (S)
  5. 2718738Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)
  6. 2718739Protein Ribosomal protein S7 [47975] (4 species)
  7. 2718769Species Thermus thermophilus [TaxId:274] [47977] (47 PDB entries)
    Uniprot P17291
  8. 2718805Domain d1i97g_: 1i97 G: [62065]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97g_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
PDB Compounds: (G:) 30S ribosomal protein S7

SCOPe Domain Sequences for d1i97g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97g_ a.75.1.1 (G:) Ribosomal protein S7 {Thermus thermophilus [TaxId: 274]}
arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
helmdaaegkggavkkkedvermaeanrayahyrw

SCOPe Domain Coordinates for d1i97g_:

Click to download the PDB-style file with coordinates for d1i97g_.
(The format of our PDB-style files is described here.)

Timeline for d1i97g_: