SCOP 1.75: Domain d1i97f_: 1i97 F:

Lineage for d1i97f_ (1i97 F:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family)

5. Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)

6. Protein Ribosomal protein S6 [54997] (4 species)

7. Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
   Uniprot P23370

8. Domain d1i97f_: 1i97 F: [62064]
   Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
   complexed with mg, tac, wo2, zn

Details for d1i97f_

PDB Entry: 1i97, 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

PDB Compounds: (F:) 30S ribosomal protein S6

SCOP Domain Sequences for d1i97f_:

Sequence; same for both SEQRES and ATOM records:

>d1i97f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

Timeline for d1i97f_:

• d1i97f_ first appeared in SCOP 1.57
  
• d1i97f_ appears in SCOP 1.73
  
• d1i97f_ appears in SCOPe 2.01
  
• d1i97f_ appears in the current release, SCOPe 2.08