Lineage for d1i97f_ (1i97 F:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 80004Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 80538Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 80539Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 80540Protein Ribosomal protein S6 [54997] (1 species)
  7. 80541Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries)
  8. 80552Domain d1i97f_: 1i97 F: [62064]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97o_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_

Details for d1i97f_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline

SCOP Domain Sequences for d1i97f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97f_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOP Domain Coordinates for d1i97f_:

Click to download the PDB-style file with coordinates for d1i97f_.
(The format of our PDB-style files is described here.)

Timeline for d1i97f_: