Lineage for d1i97o_ (1i97 O:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764625Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 764626Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) (S)
  5. 764635Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
  6. 764636Protein Ribosomal protein S15 [47065] (3 species)
  7. 764650Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 764679Domain d1i97o_: 1i97 O: [62073]
    Other proteins in same PDB: d1i97b_, d1i97c1, d1i97c2, d1i97d_, d1i97e1, d1i97e2, d1i97f_, d1i97g_, d1i97h_, d1i97i_, d1i97j_, d1i97k_, d1i97l_, d1i97m_, d1i97n_, d1i97p_, d1i97q_, d1i97r_, d1i97s_, d1i97t_, d1i97u_
    complexed with mg, tac, wo2, zn

Details for d1i97o_

PDB Entry: 1i97 (more details), 4.5 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tetracycline
PDB Compounds: (O:) 30S ribosomal protein S15

SCOP Domain Sequences for d1i97o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i97o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOP Domain Coordinates for d1i97o_:

Click to download the PDB-style file with coordinates for d1i97o_.
(The format of our PDB-style files is described here.)

Timeline for d1i97o_: