Lineage for d1i96o_ (1i96 O:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697722Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2697723Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2697777Family a.16.1.2: Ribosomal protein S15 [47064] (1 protein)
    contains additional N-terminal helix that forms a separate unit
    automatically mapped to Pfam PF00312
  6. 2697778Protein Ribosomal protein S15 [47065] (3 species)
  7. 2697792Species Thermus thermophilus [TaxId:274] [47067] (42 PDB entries)
    Uniprot P80378
  8. 2697820Domain d1i96o_: 1i96 O: [62050]
    Other proteins in same PDB: d1i96b_, d1i96c1, d1i96c2, d1i96d_, d1i96e1, d1i96e2, d1i96f_, d1i96g_, d1i96h_, d1i96i_, d1i96j_, d1i96k_, d1i96l_, d1i96m_, d1i96n_, d1i96p_, d1i96q_, d1i96r_, d1i96s_, d1i96t_, d1i96u_, d1i96v_
    complexed with mg, wo2, zn

Details for d1i96o_

PDB Entry: 1i96 (more details), 4.2 Å

PDB Description: crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with the translation initiation factor if3 (c-terminal domain)
PDB Compounds: (O:) 30S ribosomal protein S15

SCOPe Domain Sequences for d1i96o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i96o_ a.16.1.2 (O:) Ribosomal protein S15 {Thermus thermophilus [TaxId: 274]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1i96o_:

Click to download the PDB-style file with coordinates for d1i96o_.
(The format of our PDB-style files is described here.)

Timeline for d1i96o_: