Lineage for d1i75b3 (1i75 B:407-496)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328053Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 1328095Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (8 PDB entries)
    Uniprot P05618
  8. 1328103Domain d1i75b3: 1i75 B:407-496 [61875]
    Other proteins in same PDB: d1i75a1, d1i75a2, d1i75a4, d1i75b1, d1i75b2, d1i75b4
    complexed with ca, noj

Details for d1i75b3

PDB Entry: 1i75 (more details), 2 Å

PDB Description: crystal structure of cyclodextrin glucanotransferase from alkalophilic bacillus sp.#1011 complexed with 1-deoxynojirimycin
PDB Compounds: (B:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1i75b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i75b3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011 [TaxId: 1409]}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOPe Domain Coordinates for d1i75b3:

Click to download the PDB-style file with coordinates for d1i75b3.
(The format of our PDB-style files is described here.)

Timeline for d1i75b3: