Lineage for d1i75a2 (1i75 A:583-686)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1301409Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) (S)
  5. 1301410Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 1301446Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 1301488Species Bacillus sp., strain 1011 [TaxId:1409] [49458] (8 PDB entries)
    Uniprot P05618
  8. 1301495Domain d1i75a2: 1i75 A:583-686 [61870]
    Other proteins in same PDB: d1i75a1, d1i75a3, d1i75a4, d1i75b1, d1i75b3, d1i75b4
    complexed with ca, noj

Details for d1i75a2

PDB Entry: 1i75 (more details), 2 Å

PDB Description: crystal structure of cyclodextrin glucanotransferase from alkalophilic bacillus sp.#1011 complexed with 1-deoxynojirimycin
PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOPe Domain Sequences for d1i75a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i75a2 b.3.1.1 (A:583-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus sp., strain 1011 [TaxId: 1409]}
tgdqvtvrfvinnattalgqnvfltgnvselgnwdpnnaigpmynqvvyqyptwyydvsv
pagqtiefkflkkqgstvtwegganrtfttptsgtatvnvnwqp

SCOPe Domain Coordinates for d1i75a2:

Click to download the PDB-style file with coordinates for d1i75a2.
(The format of our PDB-style files is described here.)

Timeline for d1i75a2: