Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries) |
Domain d1i6vb2: 1i6v B:50-172 [61855] Other proteins in same PDB: d1i6va1, d1i6vb1, d1i6vc_, d1i6vd_, d1i6ve_ complexed with mg, rfp, zn |
PDB Entry: 1i6v (more details), 3.3 Å
SCOP Domain Sequences for d1i6vb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1i6vb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev ravdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda ifs
Timeline for d1i6vb2: