SCOP 1.65: Domain d1i6hi1: 1i6h I:2-49

Lineage for d1i6hi1 (1i6h I:2-49)

Root: SCOP 1.65
Class g: Small proteins [56992] (66 folds)
Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families)
Family g.41.3.1: Transcriptional factor domain [57784] (3 proteins)
Protein RBP9 subunit of RNA polymerase II [57787] (2 species)
contains two differently decorated domains of this fold
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (4 PDB entries)
Domain d1i6hi1: 1i6h I:2-49 [61839]
Other proteins in same PDB: d1i6ha_, d1i6hb_, d1i6hc1, d1i6hc2, d1i6he1, d1i6he2, d1i6hf_, d1i6hh_, d1i6hj_, d1i6hk_, d1i6hl_

Details for d1i6hi1

PDB Entry: 1i6h (more details), 3.3 Å

PDB Description: rna polymerase ii elongation complex

SCOP Domain Sequences for d1i6hi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i6hi1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae)}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

SCOP Domain Coordinates for d1i6hi1:

Click to download the PDB-style file with coordinates for d1i6hi1.
(The format of our PDB-style files is described here.)

Timeline for d1i6hi1: