Lineage for d1i5pa2 (1i5p A:264-472)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079052Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2079059Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) (S)
  5. 2079060Family b.77.2.1: delta-Endotoxin (insectocide), middle domain [51097] (1 protein)
  6. 2079061Protein delta-Endotoxin (insectocide), middle domain [51098] (5 species)
  7. 2079062Species Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId:29339] [63846] (1 PDB entry)
  8. 2079063Domain d1i5pa2: 1i5p A:264-472 [61818]
    Other proteins in same PDB: d1i5pa1, d1i5pa3

Details for d1i5pa2

PDB Entry: 1i5p (more details), 2.2 Å

PDB Description: insecticidal crystal protein cry2aa
PDB Compounds: (A:) pesticidial crystal protein cry2aa

SCOPe Domain Sequences for d1i5pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i5pa2 b.77.2.1 (A:264-472) delta-Endotoxin (insectocide), middle domain {Bacillus thuringiensis subsp. kurstaki, CRY2AA [TaxId: 29339]}
yqslmvssganlyasgsgpqqtqsftaqnwpflyslfqvnsnyilsgisgtrlsitfpni
gglpgsttthslnsarvnysggvssgligatnlnhnfncstvlpplstpfvrswldsgtd
regvatstnwqtesfqttlslrcgafsargnsnyfpdyfirnisgvplvirnedltrplh
ynqirniespsgtpggaraylvsvhnrkn

SCOPe Domain Coordinates for d1i5pa2:

Click to download the PDB-style file with coordinates for d1i5pa2.
(The format of our PDB-style files is described here.)

Timeline for d1i5pa2: