Lineage for d1i58b_ (1i58 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213473Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2213486Protein Histidine kinase CheA [55887] (1 species)
  7. 2213487Species Thermotoga maritima [TaxId:2336] [55888] (8 PDB entries)
  8. 2213489Domain d1i58b_: 1i58 B: [61774]
    ATP-binding domain (p4) only
    complexed with acp, act, adp, mg

Details for d1i58b_

PDB Entry: 1i58 (more details), 1.6 Å

PDB Description: structure of the histidine kinase chea atp-binding domain in complex with atp analog adpcp and magnesium
PDB Compounds: (B:) chemotaxis protein chea

SCOPe Domain Sequences for d1i58b_:

Sequence, based on SEQRES records: (download)

>d1i58b_ d.122.1.3 (B:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
hmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidh
giepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglidesk
aatlsdqeilnflfvpgfstkekvsevsgrgvgmdvvknvveslngsisiesekdkgtkv
tirlplt

Sequence, based on observed residues (ATOM records): (download)

>d1i58b_ d.122.1.3 (B:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]}
hmvpisfvfnrfprmvrdlakkmnkevnfimrgedteldrtfveeigepllhllrnaidh
giepkeeriakgkppigtlilsarhegnnvvieveddgrgidkekiirkaiekglidesk
aatlsdqeilnflfvpgfsvgmdvvknvveslngsisiesekdkgtkvtirlplt

SCOPe Domain Coordinates for d1i58b_:

Click to download the PDB-style file with coordinates for d1i58b_.
(The format of our PDB-style files is described here.)

Timeline for d1i58b_: