Class b: All beta proteins [48724] (174 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.8: RNA polymerase subunit RBP8 [50321] (1 protein) duplication; contains tandem repeat of two incomplete OB-folds; forms a single barrel; n=8, S=10 |
Protein RNA polymerase subunit RBP8 [50322] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50323] (30 PDB entries) Uniprot P20436 |
Domain d1i50h_: 1i50 H: [61761] Other proteins in same PDB: d1i50a_, d1i50b_, d1i50c1, d1i50c2, d1i50e1, d1i50e2, d1i50f_, d1i50i1, d1i50i2, d1i50j_, d1i50k_, d1i50l_ protein/RNA complex; complexed with mn, zn |
PDB Entry: 1i50 (more details), 2.8 Å
SCOPe Domain Sequences for d1i50h_:
Sequence, based on SEQRES records: (download)
>d1i50h_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias slnledtpandssatrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggl lmrlegnyrnlnnlkqenayllirr
>d1i50h_ b.40.4.8 (H:) RNA polymerase subunit RBP8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sntlfddifqvsevdpgrynkvcrieaasttqdqckltldinvelfpvaaqdsltvtias sltrswrppqagdrsladdydyvmygtaykfeevskdliavyysfggllmrlegnyrnln nlkqenayllirr
Timeline for d1i50h_: