Lineage for d1i4kv_ (1i4k V:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123076Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1123077Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1123078Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1123079Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1123080Species Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)
  8. 1123104Domain d1i4kv_: 1i4k V: [61713]
    complexed with cit

Details for d1i4kv_

PDB Entry: 1i4k (more details), 2.5 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus at 2.5a resolution
PDB Compounds: (V:) putative snrnp sm-like protein

SCOPe Domain Sequences for d1i4kv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i4kv_ b.38.1.1 (V:) Archaeal homoheptameric Sm protein {Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspa

SCOPe Domain Coordinates for d1i4kv_:

Click to download the PDB-style file with coordinates for d1i4kv_.
(The format of our PDB-style files is described here.)

Timeline for d1i4kv_: