SCOP 1.61: Domain d1i4kl_: 1i4k L:

Lineage for d1i4kl_ (1i4k L:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.38: Sm-like fold [50181] (2 superfamilies)

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (2 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)

6. Protein Archaeal homoheptameric Sm protein [63758] (4 species)

7. Species Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId:2234] [63761] (2 PDB entries)

8. Domain d1i4kl_: 1i4k L: [61703]

Details for d1i4kl_

PDB Entry: 1i4k, 2.5 Å

PDB Description: crystal structure of an sm-like protein (af-sm1) from archaeoglobus fulgidus at 2.5a resolution

SCOP Domain Sequences for d1i4kl_:

Sequence; same for both SEQRES and ATOM records:

>d1i4kl_ b.38.1.1 (L:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1}
prpldvlnrslkspvivrlkggrefrgtldgydihmnlvlldaeeiqngevvrkvgsvvi
rgdtvvfvspa

Timeline for d1i4kl_:

• d1i4kl_ first appeared in SCOP 1.57
  
• d1i4kl_ appears in SCOP 1.59
  
• d1i4kl_ appears in SCOP 1.63
  
• d1i4kl_ appears in the current release, SCOPe 2.08