Lineage for d1hzhk4 (1hzh K:360-475)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 160122Species Intact IgG B12 antibody (human), kappa L chain [63652] (1 PDB entry)
  8. 160128Domain d1hzhk4: 1hzh K:360-475 [61444]
    Other proteins in same PDB: d1hzhh1, d1hzhk1, d1hzhl1, d1hzhm1

Details for d1hzhk4

PDB Entry: 1hzh (more details), 2.7 Å

PDB Description: crystal structure of the intact human igg b12 with broad and potent activity against primary hiv-1 isolates: a template for hiv vaccine design

SCOP Domain Sequences for d1hzhk4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hzhk4 b.1.1.2 (K:360-475) Immunoglobulin (constant domains of L and H chains) {Intact IgG B12 antibody (human), kappa L chain}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

SCOP Domain Coordinates for d1hzhk4:

Click to download the PDB-style file with coordinates for d1hzhk4.
(The format of our PDB-style files is described here.)

Timeline for d1hzhk4: