Lineage for d1hxdb2 (1hxd B:271-317)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58264Fold b.34: SH3-like barrel [50036] (9 superfamilies)
  4. 58265Superfamily b.34.1: C-terminal domain of biotin and diphtheria toxin repressors [50037] (2 families) (S)
  5. 58266Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein)
  6. 58267Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)
  7. 58268Species Escherichia coli [TaxId:562] [50040] (3 PDB entries)
  8. 58271Domain d1hxdb2: 1hxd B:271-317 [61364]
    Other proteins in same PDB: d1hxda1, d1hxda3, d1hxdb1, d1hxdb3

Details for d1hxdb2

PDB Entry: 1hxd (more details), 2.4 Å

PDB Description: crystal structure of e. coli biotin repressor with bound biotin

SCOP Domain Sequences for d1hxdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hxdb2 b.34.1.1 (B:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

SCOP Domain Coordinates for d1hxdb2:

Click to download the PDB-style file with coordinates for d1hxdb2.
(The format of our PDB-style files is described here.)

Timeline for d1hxdb2: