SCOP 1.59: Domain d1hxdb2: 1hxd B:271-317

Lineage for d1hxdb2 (1hxd B:271-317)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.34: SH3-like barrel [50036] (9 superfamilies)

4. Superfamily b.34.1: C-terminal domain of transcriptional repressors [50037] (3 families)

5. Family b.34.1.1: Biotin repressor (BirA) [50038] (1 protein)

6. Protein Biotin repressor/biotin holoenzyme synthetase, C-terminal domain [50039] (1 species)

7. Species Escherichia coli [TaxId:562] [50040] (3 PDB entries)

8. Domain d1hxdb2: 1hxd B:271-317 [61364]
   Other proteins in same PDB: d1hxda1, d1hxda3, d1hxdb1, d1hxdb3

Details for d1hxdb2

PDB Entry: 1hxd, 2.4 Å

PDB Description: crystal structure of e. coli biotin repressor with bound biotin

SCOP Domain Sequences for d1hxdb2:

Sequence; same for both SEQRES and ATOM records:

>d1hxdb2 b.34.1.1 (B:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli}
finrpvkliigdkeifgisrgidkqgallleqdgiikpwmggeislr

Timeline for d1hxdb2:

• d1hxdb2 first appeared in SCOP 1.57
  
• d1hxdb2 appears in SCOP 1.61
  
• d1hxdb2 appears in the current release, SCOPe 2.08