Lineage for d1hv5f_ (1hv5 F:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 82192Fold d.92: Zincin-like [55485] (2 superfamilies)
  4. 82193Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (13 families) (S)
  5. 82321Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (8 proteins)
  6. 82420Protein Stromelysin-3 (MMP-11) [64341] (1 species)
  7. 82421Species Mouse (Mus musculus) [TaxId:10090] [64342] (1 PDB entry)
  8. 82427Domain d1hv5f_: 1hv5 F: [61293]

Details for d1hv5f_

PDB Entry: 1hv5 (more details), 2.6 Å

PDB Description: crystal structure of the stromelysin-3 (mmp-11) catalytic domain complexed with a phosphinic inhibitor

SCOP Domain Sequences for d1hv5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hv5f_ d.92.1.11 (F:) Stromelysin-3 (MMP-11) {Mouse (Mus musculus)}
mfvlsggrwektdltyrilrfpwqlvreqvrqtvaealqvwsevtpltftevhegradim
idfarywhgdnlpfdgpggilahaffpkthregdvhfdydetwtigdnqgtdllqvaahe
fghvlglqhttaakalmspfytfryplslspddrrgiqhlyg

SCOP Domain Coordinates for d1hv5f_:

Click to download the PDB-style file with coordinates for d1hv5f_.
(The format of our PDB-style files is described here.)

Timeline for d1hv5f_: