Lineage for d1hh5a_ (1hh5 A:)
- Root: SCOP 1.59
Class a: All alpha proteins [46456] (151 folds) 
Fold a.138: Multiheme cytochromes [48694] (1 superfamily) Superfamily a.138.1: Multiheme cytochromes [48695] (3 families) 
Family a.138.1.1: Cytochrome c3-like [48696] (3 proteins) 
Protein Cytochrome c7 (cytochrome c551.5) [48703] (1 species) Species Desulfuromonas acetoxidans [TaxId:891] [48704] (6 PDB entries) 
Domain d1hh5a_: 1hh5 A: [61041]
Details for d1hh5a_
PDB Entry: 1hh5 (more details), 1.9 Å
PDB Description: cytochrome c7 from desulfuromonas acetoxidans
SCOP Domain Sequences for d1hh5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hh5a_ a.138.1.1 (A:) Cytochrome c7 (cytochrome c551.5) {Desulfuromonas acetoxidans}
advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
kcggchik
SCOP Domain Coordinates for d1hh5a_:
Click to download the PDB-style file with coordinates for d1hh5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hh5a_:
- d1hh5a_ first appeared in SCOP 1.57
- d1hh5a_ appears in SCOP 1.61
- d1hh5a_ appears in the current release, SCOPe 2.08
View in 3D