PDB entry 1hh5

View 1hh5 on RCSB PDB site
Description: cytochrome c7 from desulfuromonas acetoxidans
Deposited on 2000-12-21, released 2001-05-03
The last revision prior to the SCOP 1.59 freeze date was dated 2001-05-03, with a file datestamp of 2001-05-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.194
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.59: d1hh5a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1hh5A (A:)
  advvtyenkkgnvtfdhkahaeklgcdachegtpakiaidkksahkdacktchksnngpt
  kcggchik