SCOPe 2.01: Domain d1hh4d_: 1hh4 D:

Lineage for d1hh4d_ (1hh4 D:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.8: RhoGDI-like [81288] (3 proteins)

6. Protein Rho GDP-dissociation inhibitor 1, RhoGDI [49241] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49242] (11 PDB entries)

8. Domain d1hh4d_: 1hh4 D: [61039]
   Other proteins in same PDB: d1hh4a_, d1hh4b_
   complex with rac1
   complexed with gdp, ger, mg

Details for d1hh4d_

PDB Entry: 1hh4, 2.7 Å

PDB Description: rac1-rhogdi complex involved in nadph oxidase activation

PDB Compounds: (D:) rho GDP-dissociation inhibitor 1

SCOPe Domain Sequences for d1hh4d_:

Sequence, based on SEQRES records:

>d1hh4d_ b.1.18.8 (D:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
eqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrvavsadpnvp
nvvvtgltlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmky
iqhtyrkgvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktd
hlswewnltikkd

Sequence, based on observed residues (ATOM records):

>d1hh4d_ b.1.18.8 (D:) Rho GDP-dissociation inhibitor 1, RhoGDI {Human (Homo sapiens) [TaxId: 9606]}
eqlaqiaaeneedehsvnykppaqksiqeiqeldkddeslrkykeallgrnvpnvvvtgl
tlvcssapgpleldltgdlesfkkqsfvlkegveyrikisfrvnreivsgmkyiqhtyrk
gvkidktdymvgsygpraeeyefltpveeapkgmlargsysiksrftdddktdhlswewn
ltikkd

Timeline for d1hh4d_:

• d1hh4d_ first appeared in SCOP 1.57
  
• d1hh4d_ appears in SCOP 1.75
  
• d1hh4d_ appears in SCOPe 2.02
  
• d1hh4d_ appears in the current release, SCOPe 2.08