SCOP 1.57: Domain d1hfob_: 1hfo B:

Lineage for d1hfob_ (1hfo B:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)

4. Superfamily d.80.1: Tautomerase/MIF [55331] (3 families)

5. Family d.80.1.3: MIF-related [55339] (2 proteins)

6. Protein Microphage migration inhibition factor (MIF) [55340] (4 species)

7. Species Trichina (Trichinella spiralis) [64323] (1 PDB entry)

8. Domain d1hfob_: 1hfo B: [61007]

Details for d1hfob_

PDB Entry: 1hfo, 1.65 Å

PDB Description: the structure of the macrophage migration inhibitory factor from trichinella spiralis.

SCOP Domain Sequences for d1hfob_:

Sequence; same for both SEQRES and ATOM records:

>d1hfob_ d.80.1.3 (B:) Microphage migration inhibition factor (MIF) {Trichina (Trichinella spiralis)}
piftlntnikatdvpsdflsstsalvgnilskpgsyvavhintdqqlsfggstnpaafgt
lmsiggiepsrnrdhsaklfdhlntklgipknrmyihfvnlngddvgwngttf

Timeline for d1hfob_:

• d1hfob_ is new in SCOP 1.57
  
• d1hfob_ appears in SCOP 1.59
  
• d1hfob_ appears in the current release, SCOPe 2.08