Class a: All alpha proteins [46456] (289 folds) |
Fold a.69: Left-handed superhelix [47916] (4 superfamilies) core: 4-5 helices; bundle; left-handed superhelix |
Superfamily a.69.1: C-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [47917] (3 families) |
Family a.69.1.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47918] (2 proteins) |
Protein F1 ATP synthase alpha subunit, domain 3 [88886] (5 species) |
Species Cow (Bos taurus) [TaxId:9913] [88893] (15 PDB entries) Uniprot P19483 |
Domain d1h8eb1: 1h8e B:380-510 [60741] Other proteins in same PDB: d1h8ea2, d1h8ea3, d1h8eb2, d1h8eb3, d1h8ec2, d1h8ec3, d1h8ed1, d1h8ed2, d1h8ed3, d1h8ee1, d1h8ee2, d1h8ee3, d1h8ef1, d1h8ef2, d1h8ef3, d1h8eg_, d1h8eh_, d1h8ei_ complexed with adp, alf, gol, mg, so4 |
PDB Entry: 1h8e (more details), 2 Å
SCOPe Domain Sequences for d1h8eb1:
Sequence, based on SEQRES records: (download)
>d1h8eb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaafaqfgsdldaatqqllsrgvrltellkqgqyspmaie eqvaviyagvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklke ivtnflagfea
>d1h8eb1 a.69.1.1 (B:380-510) F1 ATP synthase alpha subunit, domain 3 {Cow (Bos taurus) [TaxId: 9913]} tramkqvagtmklelaqyrevaldaatqqllsrgvrltellkqgqyspmaieeqvaviya gvrgyldklepskitkfenaflshvisqhqallgkirtdgkiseesdaklkeivtnflag fea
Timeline for d1h8eb1: