Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) |
Family c.68.1.13: Cytidylytransferase [68901] (7 proteins) |
Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species) |
Species Escherichia coli, KpsU [TaxId:562] [64144] (8 PDB entries) capsule-specific enzyme |
Domain d1h7ta_: 1h7t A: [60730] complexed with c5p, sia |
PDB Entry: 1h7t (more details), 2.48 Å
SCOPe Domain Sequences for d1h7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h7ta_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]} skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe laena
Timeline for d1h7ta_: