SCOPe 2.08: Domain d1h7ta_: 1h7t A:

Lineage for d1h7ta_ (1h7t A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (7 proteins)

6. Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase [64143] (3 species)

7. Species Escherichia coli, KpsU [TaxId:562] [64144] (8 PDB entries)
   capsule-specific enzyme

8. Domain d1h7ta_: 1h7t A: [60730]
   complexed with c5p, sia

Details for d1h7ta_

PDB Entry: 1h7t, 2.48 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, here complex with cmp-neuac

PDB Compounds: (A:) 3-deoxy-manno-octulosonate cytidylyltransferase

SCOPe Domain Sequences for d1h7ta_:

Sequence; same for both SEQRES and ATOM records:

>d1h7ta_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase {Escherichia coli, KpsU [TaxId: 562]}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
laena

Timeline for d1h7ta_:

• d1h7ta_ first appeared in SCOP 1.57
  
• d1h7ta_ appears in SCOPe 2.07