Lineage for d1h7gb_ (1h7g B:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 319172Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 319173Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families) (S)
  5. 319388Family c.68.1.13: Cytidylytransferase [68901] (3 proteins)
  6. 319394Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB [64143] (1 species)
  7. 319395Species Escherichia coli [TaxId:562] [64144] (8 PDB entries)
  8. 319399Domain d1h7gb_: 1h7g B: [60722]
    complexed with ctp, mg

Details for d1h7gb_

PDB Entry: 1h7g (more details), 2.13 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, ctp mg2+ complex

SCOP Domain Sequences for d1h7gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h7gb_ c.68.1.13 (B:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB {Escherichia coli}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
l

SCOP Domain Coordinates for d1h7gb_:

Click to download the PDB-style file with coordinates for d1h7gb_.
(The format of our PDB-style files is described here.)

Timeline for d1h7gb_: