SCOP 1.65: Domain d1h7ga_: 1h7g A:

Lineage for d1h7ga_ (1h7g A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest

4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (13 families)

5. Family c.68.1.13: Cytidylytransferase [68901] (3 proteins)

6. Protein CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB [64143] (1 species)

7. Species Escherichia coli [TaxId:562] [64144] (8 PDB entries)

8. Domain d1h7ga_: 1h7g A: [60721]

Details for d1h7ga_

PDB Entry: 1h7g, 2.13 Å

PDB Description: the structure of cmp:2-keto-3-deoxy-manno-octonic acid synthetase and of its complexes with substrates and substrate analogues, ctp mg2+ complex

SCOP Domain Sequences for d1h7ga_:

Sequence; same for both SEQRES and ATOM records:

>d1h7ga_ c.68.1.13 (A:) CMP:2-keto-3-deoxy-manno-octonic acid (CMP-KDO)synthetase, KdsB {Escherichia coli}
skaviviparygssrlpgkplldivgkpmiqhvyeralqvagvaevwvatddprveqavq
afggkaimtrndhesgtdrlvevmhkveadiyinlqgdepmirprdvetllqgmrddpal
pvatlchaisaaeaaepstvkvvvntrqdalyfsrspipyprnaekarylkhvgiyayrr
dvlqnysqlpesmpeqaesleqlrlmnaginirtfevaatgpgvdtpaclekvralmaqe
laena

Timeline for d1h7ga_:

• d1h7ga_ first appeared in SCOP 1.57
  
• d1h7ga_ appears in SCOP 1.63
  
• d1h7ga_ appears in SCOP 1.67
  
• d1h7ga_ appears in the current release, SCOPe 2.08