Lineage for d1h6ka2 (1h6k A:291-480)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284903Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 284904Superfamily a.118.1: ARM repeat [48371] (13 families) (S)
  5. 284957Family a.118.1.2: HEAT repeat [48385] (3 proteins)
    this is a repeat family; one repeat unit is 1b3u A:295-335 found in domain
  6. 284958Protein CBP80, 80KDa nuclear cap-binding protein [63606] (1 species)
    contains three domains of this fold connected with long linkers
  7. 284959Species Human (Homo sapiens) [TaxId:9606] [63607] (6 PDB entries)
  8. 284961Domain d1h6ka2: 1h6k A:291-480 [60676]
    Other proteins in same PDB: d1h6kx_, d1h6ky_, d1h6kz_

Details for d1h6ka2

PDB Entry: 1h6k (more details), 2 Å

PDB Description: nuclear cap binding complex

SCOP Domain Sequences for d1h6ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6ka2 a.118.1.2 (A:291-480) CBP80, 80KDa nuclear cap-binding protein {Human (Homo sapiens)}
mfdytddpegpvmpgshsverfvieenlhciikshwkerktcaaqlvsypgknkiplnyh
ivevifaelfqlpapphidvmyttllielcklqpgslpqvlaqatemlymrldtmnttcv
drfinwfshhlsnfqfrwswedwsdclsqdpespkpkfvrevlekcmrlsyhqrildivp
ptfsalcpsn

SCOP Domain Coordinates for d1h6ka2:

Click to download the PDB-style file with coordinates for d1h6ka2.
(The format of our PDB-style files is described here.)

Timeline for d1h6ka2: