Lineage for d1ghqc1 (1ghq C:1-66)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89871Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
  4. 89872Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 89873Family g.18.1.1: Complement control module/SCR domain [57536] (6 proteins)
  6. 89935Protein Complement receptor 2, cr2 [64564] (1 species)
  7. 89936Species Human (Homo sapiens) [TaxId:9606] [64565] (1 PDB entry)
  8. 89939Domain d1ghqc1: 1ghq C:1-66 [60524]
    Other proteins in same PDB: d1ghqa_

Details for d1ghqc1

PDB Entry: 1ghq (more details), 2.04 Å

PDB Description: cr2-c3d complex structure

SCOP Domain Sequences for d1ghqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghqc1 g.18.1.1 (C:1-66) Complement receptor 2, cr2 {Human (Homo sapiens)}
aiscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa
pkceyf

SCOP Domain Coordinates for d1ghqc1:

Click to download the PDB-style file with coordinates for d1ghqc1.
(The format of our PDB-style files is described here.)

Timeline for d1ghqc1: